DPCstruct | MC23082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 193 ± 33 aa |
| Standard deviation of domain lengths | 33.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.44 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | PF15254- CL0068 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7Y984 | 76-281 | MPQPDKPLVIPPELPELLKQFTQAAIRTRPPDLIQWSATYFTALQNGDPLPIKEQPERISLSDWAVLTPELLKLLHTKLAGRLTIET… |
| A0A0L7R9Z3 | 7-173 | SVSGQEIIVPPNLPLILKEFCKAAIRTQPYDLLKWSSSYFRALADGEEPPIKLRLEYPPPSTASGLTLGFLRILLRQFGDYNKSLPV… |
| A0A1Y1V200 | 9-233 | None |
| A0A6I8P8Z4 | 2-205 | None |
| A0A4C1U353 | 32-303 | None |
| A0A485N880 | 108-319 | None |
| A0A6P7FLD6 | 1-239 | None |
| D8R7Y6 | 3-179 | None |
| S9WFN6 | 1-195 | None |
| L1I8P4 | 185-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.