DPCstruct | MC23078
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 173 ± 27 aa |
| Standard deviation of domain lengths | 26.84 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 67.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.25 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 36.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9R2Z3 | 1-174 | MKAFIILLATVATSLASPGYLYGYAPLGHDGRVVDTPEVAHAKAEHLAAHAKEASKHALSYGYGPGYAPEVSYGGHHDNIKYHGPPA… |
| A0A7M7MM05 | 4-137 | TRHLLLLALSCLVLAASGAAAGYVAPYVAPYHGPPAPLAHDGRVIDTPEVAHAKAVHLATHAAEAAKASPSATAYDDYEGKYEGNGG… |
| E2C2I4 | 2-142 | None |
| A0A833VUA2 | 98-239 | None |
| A0A7E4RCY2 | 17-235 | None |
| A0A3L8DFW4 | 1-163 | None |
| F4WD93 | 68-226 | None |
| A0A6P3DH49 | 26-195 | None |
| A0A7E4RCZ8 | 1-173 | None |
| A0A834JHE6 | 1-214 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.