DPCstruct | MC23076
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 277 ± 61 aa |
| Standard deviation of domain lengths | 60.61 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 76.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 18.94 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0221- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9QIG8 | 40-275 | KLIVGHNMLLDLCHVVHQFFGPLPESYLEFKSLINGLFPKLIDTKVFSSLPPFKDLIPSSILNHIFESVTKEPFSIPEITPIENRSY… |
| A0A5F8GHL9 | 257-473 | VKAKKPLVGHNMMMDLLHLHEKFYRPLPESYEQFKLNIHGLFPVLIDTKNVTKEIWKELSFPRASNLLEVYEVLNSDLNPTKNSCPV… |
| A0A433PR11 | 9-312 | None |
| A0A7J6LX08 | 325-704 | None |
| A9PH47 | 180-432 | None |
| A0A7S4PB73 | 6-251 | None |
| A0A3S0ZPX7 | 174-428 | None |
| A0A6J1WHF9 | 1-181 | None |
| A0A835XLL9 | 556-907 | None |
| D0NBB0 | 74-439 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.