DPCstruct | MC23075
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 97 ± 11 aa |
| Standard deviation of domain lengths | 10.62 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.49 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0036- CL0108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W5LVB0 | 1-93 | MAGKPLVSRDSFNHIGVGNASLCQEVVRRIFNFSSCSFSRCSFNGVYQPPLQGPFGAFSAFYFVMNFLNLTSDSLESSREKLARYCS… |
| A0A2G9RS75 | 112-218 | TADLYSSPCVSDRRILTIPQTIQIKGTGNYQLCKDKVENIFNLSHCSYSRCSFNGIFQPMLQGEFGAFSAFYFVMDFLKVTKEKVSL… |
| A0A6J3GJX4 | 216-307 | None |
| A0A2B4S6S3 | 292-406 | None |
| A0A821IPC0 | 1-93 | None |
| A0A3P7KXI6 | 193-275 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.