DPCstruct | MC23072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 181 ± 18 aa |
| Standard deviation of domain lengths | 17.80 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6YA38 | 4-146 | LIEDQIYWSSNIDRSIDSNNDFDNDIINWIDSISKSKFIRFKSGCGRMQNRLLITDRGDKICARYRHNNEQIFGEYYSFLLARILKI… |
| A0A6P3GU52 | 1-182 | LAAGADGPPGQPPGERRRHVPTGRPGPEERAAVHGGVFWSRGLEEQVPRGFSEAQAAAWLEAARRARVVALERGGCGRSSNRLARFA… |
| A0A812C8B8 | 116-308 | None |
| T1K3W3 | 1-195 | None |
| A0A7M7HEB9 | 225-415 | None |
| A0A182F3E2 | 183-368 | None |
| A0A0M5J0C4 | 190-352 | None |
| A0A336L433 | 263-425 | None |
| C3Z7R4 | 368-565 | None |
| C3YSL0 | 15-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.