DPCstruct | MC23070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 200 ± 37 aa |
| Standard deviation of domain lengths | 36.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 36.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A401SQ76 | 10-172 | EWERLWFLILCTGFFMTLVWFYFWWEVHNDYNEFNWYMYNKKGYWNDWSVPVLVLASTGFIYVTFLLILALCHIAVGQQMNLHWLHK… |
| A0A6P3GFH4 | 11-197 | WARCFHCLYSCHWKKCPRDRMQTNKCECVWFGLLFLTFLLSLGWLYVVLILLNDLHNFNEFLFQRWGHWMDWSPAFLLVISLLVTYA… |
| A0A4Z2AZ22 | 1-256 | None |
| A0A6B0S6B4 | 3-180 | None |
| A0A6I8QH15 | 2-201 | None |
| A0A2I0TC16 | 77-318 | None |
| G3IDD5 | 10-184 | None |
| A0A3B5M9Q6 | 1-235 | None |
| A0A7J8GZX2 | 13-181 | None |
| G3SN31 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.