DPCstruct | MC2307
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 66 ± 6 aa |
| Standard deviation of domain lengths | 6.30 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 32.93 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF06988- PF14169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2VRP7 | 2-51 | IDTQIWICSNQDCNCWLRSEFSFSQMPLCPMCKSSMTNQTKPLPEIVRAN |
| A0A4Q1SUR6 | 4-73 | NQEHQPLVTESEHIQAPEADTPTEVWECEANECKGWMRKNYSLDTTPNCPLCQTQMRSGTRMIPQLKKEL |
| A0A372LKC5 | 14-84 | None |
| A0A1I0BNW3 | 19-84 | None |
| A0A480BHX4 | 246-316 | None |
| A0A3E0QU83 | 1-70 | None |
| A0A2W1LHA9 | 29-104 | None |
| A0A2W1L9F7 | 35-104 | None |
| A0A502ID91 | 2-58 | None |
| A0A559K487 | 51-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.