DPCstruct | MC23067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 90 ± 11 aa |
| Standard deviation of domain lengths | 11.35 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 44.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0FTI1 | 1-73 | MRELVNVPRALTAENGAKAALSGEFKVTRSVWCTECGGEGCTDCNDRGEWEQEITIPWPTIKEIYAAAIQHFE |
| A0A2T6NP51 | 18-108 | LYKKRAVPTASPAGYVAMPKALTAENGAKALLIGEFNEKIISDCPACLNKNGDIDDNCYLCDGTGEFVQEIQVSWTTLKEIYAMAVK… |
| A0A7Y0VP50 | 139-249 | None |
| A0A0J2GSK2 | 250-350 | None |
| A0A109KMX7 | 263-360 | None |
| A0A7Y1FTN1 | 93-187 | None |
| A0A3R7AKQ5 | 5-93 | None |
| A0A2G2CXM8 | 177-270 | None |
| A0A0J7J9Y6 | 327-394 | None |
| A0A6N8AR37 | 231-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.