DPCstruct | MC23062
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 157 ± 14 aa |
| Standard deviation of domain lengths | 14.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T4ADW1 | 10-157 | GFIRPERGGCGICGRETSRRCQACSLDWFCSQECQDQMSFNHLTLCSARSITTADKLWHYAVGDRIPQDSETREHFGFTRCRGWRDE… |
| A0A166WRG6 | 1-137 | MAERECGNPKCNEPATRRCSACTDRRGWYCSERCQRKAWPLHIFDCNTTKPAKTAYHMAIASLLNIPPPHWQTKQDYGFSKLSPEDQ… |
| A0A6A6CJR3 | 606-757 | None |
| A0A2B7XXS5 | 87-246 | None |
| A0A1Y6M0H5 | 56-224 | None |
| A0A6A6AYA7 | 512-659 | None |
| A0A1G4ATH7 | 32-215 | None |
| A0A066XG44 | 35-215 | None |
| A0A4Q9MA98 | 46-169 | None |
| A0A397SA81 | 2-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.