DPCstruct | MC2306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 83 ± 8 aa |
| Standard deviation of domain lengths | 8.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 37.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E7SZC6 | 3-69 | EQTRALDRGDGTCRHYNATNKGCGIYNERPDICRVDRQYQLHYRQAYSWDLFVALNVEVCEALQVQA |
| A0A4Q1SRR3 | 4-85 | FPCTSCGLCCQRISAVPELSGYDRGDGTCIHLVDHRCSIYEERPEICRIDHMFEKIYATQFSRPQFYLENLKVCKSLQIEAG |
| A0A1H7IQ28 | 3-81 | None |
| A0A0L6JPK8 | 1-90 | None |
| A0A554GUX0 | 6-98 | None |
| A0A7X8IYP0 | 3-82 | None |
| A0A4R1R178 | 1-89 | None |
| A0A7U0VD37 | 1-83 | None |
| A0A2U2AJL7 | 6-88 | None |
| A0A7U9XDF4 | 2-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.