DPCstruct | MC23059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 177 ± 28 aa |
| Standard deviation of domain lengths | 27.88 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 24.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T3ZWE5 | 1-177 | MPSTRKKKDTHEPVIMLSYKDLVRRIGGKPPQQVKKGDPEWEDSIKCIKAYHSQATVLSRADQEGMRFMIKRLQYVIPPEAEKNSLL… |
| G9MIB5 | 65-205 | GTVQKSTTMSAITRYDISNLGLGPDDEDYSDGVACIEAYWAYALDMTPETRDKYLGLLRNKKWTHTVSSRKQPSQHRLYKSSVGKTI… |
| G0RTV8 | 8-185 | None |
| A0A6V8QUA2 | 8-194 | None |
| A0A2N1LA66 | 1-178 | None |
| A0A2P5A399 | 12-200 | None |
| A0A2P4ZTS9 | 11-160 | None |
| A0A2T4BV09 | 39-203 | None |
| A0A2H3A3Z7 | 7-153 | None |
| A0A395NKP8 | 12-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.