DPCstruct | MC23058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 90 ± 14 aa |
| Standard deviation of domain lengths | 14.10 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C1E4K2 | 147-244 | QAAPPYIADGATVVGGDGEIKRAGTNEWTCLAGNGRTRPADGWPSVHVASPICADPEGMKWIQAYVSGKTPKLERDTIIYMQAGDEG… |
| A0A2T3ZS53 | 21-106 | NARLSEQEEAFSCKINRALASGPIQVTKDATVAEWTHDREVKVIHEGTNGWTCFPGNENHVVNVPMACDAQGLQWIKDAYAGKEKP |
| A0A2T0N597 | 9-80 | None |
| A0A1A0LVS8 | 9-79 | None |
| R1D194 | 2-118 | None |
| A0A160VHE1 | 224-306 | None |
| A0A7C5E4D3 | 100-187 | None |
| A0A0B8PSY2 | 4-95 | None |
| A0A2P9ATN5 | 35-119 | None |
| A0A2P9AAR5 | 35-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.