DPCstruct | MC23055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 89 ± 8 aa |
| Standard deviation of domain lengths | 7.75 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 62.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7I253 | 1-86 | MCPKHKLFRGYIDLEIKLREFDRCRKLYEKWAEFDPENCKMWIQFATLEAMLNDSERARGIYELAICQPRLDMPEYMWKSYIDFEV |
| A0A6G1RWZ0 | 63-150 | CPKNKLFKGYIELELQLREFDRCRKLYEKFLEFAPENCTSWIKFAELETILGDIDRARAIYELAIGQPRLDMPEVLWKSYIDFEIEQE |
| A0A816IJ45 | 116-190 | None |
| A0A3P6CFP0 | 50-138 | None |
| A0A835LGJ8 | 1-101 | None |
| A0A6P8TMB2 | 441-528 | None |
| A0A183HBI2 | 273-373 | None |
| A0A2H1BZA8 | 1-86 | None |
| A0A314L2Z6 | 452-536 | None |
| A0A2U1L7S5 | 269-355 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.