DPCstruct | MC23054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 124 ± 10 aa |
| Standard deviation of domain lengths | 9.87 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 87.88 |
| Assigned Pfam label(s) | PF00057- PF02931 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4WEH7 | 223-343 | VFNGARLSRIEWRDNSTWVLYQMDNPFIRAHMLVSTDTGYPVGVHDYEVIGDKCPGKVQRLKLTSCRGNTFTCGDGECIDISRRCNL… |
| A0A6A0GZG6 | 54-182 | YESVNNRPSLAGYLHSDIFWNNETKEWTLTSRKTPDALALYKPDEPSDYPFGKKMWQVESPICGYSKGEKVLLTLSACSSGKYSCDD… |
| A0A7R8CI81 | 198-332 | None |
| A0A7R8D5S4 | 6-135 | None |
| A0A0N7ZCC6 | 314-436 | None |
| A0A0P4VR73 | 304-423 | None |
| A0A0P4WCH5 | 160-284 | None |
| A0A0P4W890 | 106-223 | None |
| A0A5B7J0M4 | 1-140 | None |
| A0A0P4VXJ7 | 77-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.