DPCstruct | MC23053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 78 ± 6 aa |
| Standard deviation of domain lengths | 6.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.97 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0063- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6ELA8 | 96-173 | PSVNSNRIYVVDTGTDQRKPQLDTSIEPWEMTEKCGMSAPHTTHCLGSGDIMISCMGDPKGDAKGGFVLIDGKSFTIK |
| A0A5B7HS15 | 2-77 | PALGSSRVYIIDISSERNPKLFKIIEPEILKSNGVSHPHTTHCLPNGQVMLSTLGDAQGKAKGSFITFDSYTFEHT |
| A0A813GZB2 | 140-219 | None |
| A0A812TWP6 | 712-813 | None |
| A0A1D6NW35 | 183-259 | None |
| A0A7J8X274 | 228-306 | None |
| A0A820A2E0 | 97-168 | None |
| A0A6V7QY21 | 449-526 | None |
| A0A1D6Q7X7 | 453-530 | None |
| A0A844MNL5 | 98-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.