DPCstruct | MC23050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 125 ± 15 aa |
| Standard deviation of domain lengths | 14.56 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 76.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7HEL1 | 2-117 | DAVDNTQCKFNLSSFKMVFVVNSDSYMYKKQALKRAKQSHEHVSQRMRSGLISWHSDWCTRHVSEADQRAATDWFLGHTDGLRPNST… |
| A0A1B0D3P7 | 141-248 | DSKAEMKLNFNSYKMVLVMNKDDVFYKRNALRRAKLTHKLVTKRMKTRFQKFIDSWLDENVAEGQKSECSDWLMGLSDDLAPNSTVL… |
| A0A2G9SP87 | 2-132 | None |
| A0A821KP19 | 1-149 | None |
| E9IDR5 | 32-139 | None |
| A0A0C9PNI3 | 87-200 | None |
| A0A4D9E658 | 1-114 | None |
| A0A212D032 | 62-187 | None |
| A0A182UGI8 | 177-301 | None |
| A0A7J8K1V6 | 160-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.