DPCstruct | MC2305
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 59 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.63 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.50 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09791 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F7TAX2 | 1-43 | MPPEAPAPEECCNSGCIPCVYDTYNEAMDEYRAALKAWRARHG |
| A0A7Z0BC10 | 5-73 | TLSDDPQPAPPVQPDLDDCCHSGCNPCVFDLYDEALDRYQAALAQWQARQERQAAEASVPVQATPKRQS |
| A0A7W9U1C6 | 7-62 | None |
| Q46QI3 | 61-113 | None |
| A0A4R5MGR3 | 3-59 | None |
| A0A0K2ZEX2 | 43-102 | None |
| A0A5D8ZEA2 | 22-83 | None |
| A0A2C6L1U1 | 250-309 | None |
| A0A1L6I9W3 | 2-50 | None |
| A0A542M3G3 | 6-56 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.