DPCstruct | MC23049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 149 ± 25 aa |
| Standard deviation of domain lengths | 24.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.96 |
| Pfam Score | 92.12 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B7HD94 | 15-179 | KGVTHTRRYTRWFGEELTAAQEMAAYALHHYSRWEDDIEAWQNPVLQDGSLPDWFKSAIFNELYFIADGGSVWLDLPEEVTSTLPLH… |
| A0A016UYL4 | 188-333 | MPDVMFGASGRWYRRRYTRFVKGASCLCARALRRREQWEKALDKWQTPILQHPQLPEWYKSALFNELYFITDGGSLWFEYDDDWSKN… |
| A0A674GCT9 | 300-452 | None |
| A0A2H2I820 | 336-489 | None |
| A0A6A3AVW8 | 110-287 | None |
| A0A0N5CTB2 | 102-266 | None |
| A0A7R9J8K5 | 39-170 | None |
| A0A4Z2BMS9 | 286-437 | None |
| A0A820RD89 | 1-101 | None |
| A0A7X1ZPK0 | 29-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.