DPCstruct | MC23048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 166 ± 18 aa |
| Standard deviation of domain lengths | 18.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0456 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0U018 | 3-140 | LDGNRWVQYVTSAENRHALPMLTSLLNTVCGYDPIGMGVPYNHLLFADTTEPLVDMCLQILIVALDSDVQQNDEAAIDNLFINYLSR… |
| A0A5B7HCN0 | 21-166 | LPLFTSLLNTVCGYNPTGLGVPYNHLLFSDYREPLVEVALQILITTLDHDITSTSPPNQEEPTMPSNLFINYLSRIHREEDFSFVLR… |
| A0A4W5KQ05 | 8-178 | None |
| A0A195AVN9 | 384-541 | None |
| A0A6L5CHS8 | 253-388 | None |
| D3BIY8 | 269-429 | None |
| S3CHD4 | 254-406 | None |
| A0A507DZG6 | 223-420 | None |
| A0A0G2G3G5 | 250-414 | None |
| A0A5K3FAR7 | 240-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.