DPCstruct | MC23045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 172 ± 31 aa |
| Standard deviation of domain lengths | 30.96 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 25.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K3M2P0 | 440-594 | CTRTVSGTHNGNLLVTSGVICLDEAQVNGTVTVRGGASLVVHGGSVNGSVLTDRAGVVQIFDTAVSGQTRISGTTTGVTVVGSTFRG… |
| A0A5B1M532 | 8-179 | LAATAAVATASAGLAIGVSSPAHADDRRCTGTIRAVQIDGDVVVPQGATCTLVGTRVDGSVKVYGNATLYARGVKVNGNVQADNHRR… |
| A0A7W1K8F6 | 1-134 | None |
| A0A1H1YJR3 | 820-972 | None |
| A0A2W2BVK0 | 659-818 | None |
| A0A848ZZT7 | 8-127 | None |
| A0A411YBX0 | 8-204 | None |
| A0A6N7GKD5 | 379-521 | None |
| A0A6C0YK19 | 6-158 | None |
| A0A1Q7Q119 | 1-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.