DPCstruct | MC23040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 164 ± 25 aa |
| Standard deviation of domain lengths | 25.09 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B8PBG6 | 2-136 | ESPEFGILQILVHSLVNASEDEHASACLLTDNLILASHHRNLPFAAAISGLGFKVALKAWTRAVEDILHAYPWDNKVDENDLYVPIV… |
| A0A165CX90 | 1-142 | MSSSSQDSPLRDLYLRVEPASDLGITTVVSRCLETEHFDVYPDNSWNKAFQNAVSKIGPTVAIKARTSAVQAVLDDAGYGARQIVLN… |
| A0A2P7ZUM8 | 9-162 | None |
| A0A1J4T5N8 | 424-608 | None |
| A0A0S6X5S3 | 42-234 | None |
| A0A4Y8DG37 | 59-208 | None |
| A0A395J675 | 2-136 | None |
| A0A4Y9Y2W2 | 4-145 | None |
| A0A163FIR5 | 284-474 | None |
| A0A0E9NQB9 | 138-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.