DPCstruct | MC2304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 58 ± 4 aa |
| Standard deviation of domain lengths | 4.48 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z2GS77 | 1-50 | MPEIAGFVSALRQAFGADEINAIVRRGHAGEPVFFAREGGIEYGTRLPSG |
| A0A7Z0B8W7 | 3-55 | EIAAFVADVKSAFGEHDVDETVRRGRAGEPTFFACENGRSVGTASSVGKDAWR |
| A0A7I8C4D5 | 6-65 | None |
| A0A6S7AY33 | 1-64 | None |
| A0A254T9R7 | 1-50 | None |
| A0A6M8SPT2 | 6-67 | None |
| A0A5E8TGG5 | 1-56 | None |
| A0A261UJ46 | 3-62 | None |
| A0A4R3HYS3 | 1-59 | None |
| A0A7Z0MUE7 | 4-65 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.