DPCstruct | MC23035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 98 ± 10 aa |
| Standard deviation of domain lengths | 10.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0254 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q6GBQ9 | 3-93 | YEDHDLDLDLRWWAAANYLTVAQIYLQDNTLLREPLRAEHIKPRLLGHWGTSPGLSMIYTLLNRHIKRTDTDWLYVTGPGHGGPALV… |
| A0A165BDS4 | 89-178 | LKLKVKGTLNADGLDSISQFRRAARYIAAAMIFFKDNVLCERDLAPDDINPRALGHWGTCPGLILVYAHLNRIIRSTNIDVLYVVAP… |
| A0A1S6J2G4 | 1-89 | None |
| A0A6G3UY59 | 1-95 | None |
| A0A1Z5TAK7 | 31-128 | None |
| A0A7W6UAR4 | 1-109 | None |
| A0A2A7R932 | 5-94 | None |
| L1KXN4 | 229-326 | None |
| A0A2T0LPM4 | 14-103 | None |
| A0A6J5E323 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.