DPCstruct | MC23028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 395 |
|---|---|
| Mean domain length (aa) | 212 ± 43 aa |
| Standard deviation of domain lengths | 42.87 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 87.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.43 |
| Pfam Score | 86.40 |
| Assigned Pfam label(s) | CL0125- CL0734- CL0040- PF10210- CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3P967 | 10-211 | IVRLGTVDSTQLEARRWLGGPEAASTPQGGGRMFIAREQTAGRGRLGRAWQSPPGGLWTTIAWNSPELQNREGRESGAWIERLGIRL… |
| T2S9Z6 | 5-153 | EKRVFESLPSTQTYLLEKLKNDELKAPILVVAKNQSAGIGSRGNVWESVKSALTFSLALNASDLPKDLPMQANALYLGFLFKEVLKE… |
| A0A2G8L5L8 | 18-257 | None |
| A0A3S0ZQT7 | 11-260 | None |
| A0A1Q9CL49 | 602-847 | None |
| A0A066V7W3 | 51-362 | None |
| A0A563VJA5 | 3-126 | None |
| A0A2H6KEA1 | 262-516 | None |
| A0A0D3CHI2 | 145-366 | None |
| A0A0D8XKB2 | 794-1029 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.