DPCstruct | MC23023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 72 ± 4 aa |
| Standard deviation of domain lengths | 3.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 55.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3KY31 | 299-367 | GSCPADFDDGTGLGEPDGGVTIDDLLYYLSIFEAGVPCADVDDGSGTGVPDGGVTIDDLLFFLVRFESG |
| A0A7C3KYB4 | 245-313 | PDTLCVADVDDGKGTGTPDGGVTIDDLLYYIAIFADGVPAADIDNGTSTGTPDGGVTIDDLLYFLLRFE |
| A0A7D8UGK3 | 690-755 | None |
| A0A7D8YFP5 | 40-108 | None |
| A0A7D8YJA6 | 694-761 | None |
| A0A7D8YUF4 | 206-276 | None |
| A0A7T9EDM3 | 346-417 | None |
| A0A7T9EDQ2 | 559-628 | None |
| A0A7T9EED3 | 525-594 | None |
| A0A7T9IGC6 | 235-302 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.