DPCstruct | MC2302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 116 ± 9 aa |
| Standard deviation of domain lengths | 8.82 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 59.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7BGM6 | 1-99 | MTKSAKNQPASRPPVDALQYEKLALSAFDLCDRQMGQLDTLITLASSIVRNPAMTRDERRRHRTLLELLVDTAEQYQQEVGCDRELF… |
| A0A7Y9WLB4 | 1-108 | MSKSPKSSRTASRPCVDAIQYEKLALSAFRLIERQIAQLNTLSTLATSIYQNPAITPDERARQRTLLGLWVETAEEYRQEVEVDREL… |
| Q13U87 | 1-121 | None |
| A0A248VHW8 | 1-121 | None |
| A0A4R0WKA1 | 1-116 | None |
| A0A1Q8ILC1 | 1-122 | None |
| A0A2N8Q930 | 2-122 | None |
| A0A495TTM5 | 1-103 | None |
| A0A1A9MXV0 | 1-125 | None |
| A0A329CMN6 | 1-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.