DPCstruct | MC23018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 76 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2SPW0 | 4-72 | QPPTELADLVGARAAGGETQMGMRGYTVARQQGLTAFWWNPTTQVCAKTVTNNGRYETVATATRAECGM |
| A0A0R0CAB8 | 25-96 | AAQDPAPDLGDLQGAADRAAARTLDSRGYVRQSGSGDYGSWWNARDRRCVMVRSDRGRVVSAVSTSPLDCGQ |
| W2URR0 | 82-154 | None |
| A0A7W5XMT4 | 1-86 | None |
| A0A560LHW1 | 113-179 | None |
| A0A7T3R4Z0 | 157-254 | None |
| A0A858X310 | 1-86 | None |
| A0A1E7H6C5 | 87-169 | None |
| A0A859QCS4 | 145-232 | None |
| A0A2T4I1P6 | 125-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.