DPCstruct | MC23011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 140 ± 15 aa |
| Standard deviation of domain lengths | 14.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 16.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A317T604 | 1-133 | MENIPVLRILLDQDQFDELYRELCKFFDAGDYSDLKRLLQGGSIDRKIIFLSNQNRLVEVFRRLKYNGFLFETSTGVRNWLCHNFLY… |
| A0A255YXV7 | 3-132 | EKRKKTVSSCETASFNYIHYNNDQPNITYLMDSLKRNALIHQETKIGNLRSVFSGRPVEQKIIWTGNISELAHFIKTLHNTAKKVED… |
| A0A1K1P0F6 | 6-150 | None |
| A0A482TNV7 | 292-421 | None |
| A0A4R7D2F5 | 37-180 | None |
| A0A3S4UZ60 | 257-366 | None |
| A0A4Y9IL83 | 122-272 | None |
| A0A7G9L7E5 | 526-660 | None |
| A0A4Q9V4L0 | 141-273 | None |
| A0A2T5RKQ5 | 160-305 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.