DPCstruct | MC23007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 213 ± 29 aa |
| Standard deviation of domain lengths | 28.76 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T2DMV0 | 2-214 | PKDMDDFLDFILNELGEGTWVPLYKNLNKEDKSEDGSLYSCLVSPGNTQKAMEGYGWDLLPGSGGPSIVSSGKDNIWYEPNSSEYLP… |
| A0A1P8LXB6 | 237-458 | WVVLESVIKQVDPQARKGWRGLREQAAVDTLLIAADAAEEFLTDLPDDPHHQIPDLFDSHGHTGCCYVGEVGRVGGSCCHRHDQLRP… |
| A0A134AFA2 | 191-379 | None |
| R5FW99 | 324-558 | None |
| A0A521DNA5 | 7-228 | None |
| A0A519Q4U6 | 21-204 | None |
| A0A378N6F1 | 470-706 | None |
| N9PCD2 | 329-581 | None |
| A0A7W6Y201 | 456-691 | None |
| A0A849QPP3 | 288-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.