DPCstruct | MC230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 34 |
|---|---|
| Mean domain length (aa) | 128 ± 23 aa |
| Standard deviation of domain lengths | 22.61 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.80 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10259 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0QTF2 | 7-123 | SKRRFPYSAQLDHCFSPPLPSDILVDFSVHQARVLVEAFVVAPSTKPVDELLSSSAKKEFVGQVTLFRGQSVEIMRQTSVWLDLPGL… |
| Q4R4U7 | 15-133 | LTTPATLTLPEIAASGLTRMFAPTLPSDLLVNVYINLNKLCLTVYQLHALQPNPTKNFRPAGGAVLHSPGAMFEWGSQRLEVSHVHK… |
| A0A397SKV0 | 247-383 | None |
| A0A5J5CXZ4 | 80-220 | None |
| A0A397U780 | 1-98 | None |
| E4ZUG0 | 307-432 | None |
| T1GMS1 | 32-150 | None |
| A0A1Y1WN84 | 105-248 | None |
| H0YY45 | 593-713 | None |
| B8NAW1 | 92-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.