DPCstruct | MC23
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 367 ± 24 aa |
| Standard deviation of domain lengths | 23.80 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 35.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R7SU20 | 1-336 | YNLLPSQLSRLQRDLRTELKIPQWAESHKRLVEDPGSPQRLDALARDMVNELNLKRGARHPWYDPETSMTDAVREALLAKAGYRRNK… |
| A0A3E0A4P5 | 28-390 | RAQNTEDHLFVADSLKWLHPHMTLAQRLQLQRSYNLTQNQLCRLRTESGDGQIPQWAEQHKRLTLDATNEQRFKLIGEELENYVEEL… |
| A0A5E7Q7J5 | 230-579 | None |
| A0A7Y9VW73 | 121-500 | None |
| E0WRM3 | 51-391 | None |
| A0A1P8EWI8 | 265-668 | None |
| J3ESP1 | 497-853 | None |
| A0A2U8I392 | 358-714 | None |
| A0A2N7XHW1 | 171-587 | None |
| A0A448E1X8 | 191-558 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.