DPCstruct | MC22999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 205 ± 30 aa |
| Standard deviation of domain lengths | 30.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 72.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E4II44 | 1-165 | MWCWWCCHPFDGSPLQLPYKHDDRRNTFTTTGNFCSWSCMKSYAIDKYGVNRGGIICGNIIMMRRRMYNQSGHVKPAPPRYSLDVFG… |
| A0A6C0CDJ2 | 37-211 | LPGYEKEDCNINNININSSNSVCWNCCHCINDEVLSQPIKYENNVFTTVGNFCSYSCISRYIIDSNESSENIFNKLSTLNLYYNIKN… |
| A0A6C0CQZ6 | 16-236 | None |
| A0A6C0LZN1 | 30-209 | None |
| A0A6C0HUC6 | 48-253 | None |
| A0A2E7HPD1 | 14-189 | None |
| A0A6C0H1N0 | 101-299 | None |
| A0A6C0H4Z6 | 7-218 | None |
| A0A835Y8A1 | 62-287 | None |
| A0A6C0JUZ4 | 1-237 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.