DPCstruct | MC22998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 167 |
|---|---|
| Mean domain length (aa) | 192 ± 29 aa |
| Standard deviation of domain lengths | 29.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.83 |
| Pfam Score | 67.18 |
| Assigned Pfam label(s) | PF08942- CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0ZMG1 | 26-238 | PVVAAFCDSCEFLSLGCYCGPACTLKSLGLKKVTYPFDWVRTPADGVIHCLQTNFEDFLTFTNIRAEGPEGKSFASAKWGGSFWHHD… |
| A0A6C0CD41 | 3-196 | FNYLTIGFDCSPAAALKELNLREFALPFDWIVCNIKSIQICFETKFKDFHKNLTFNHNKTRLIDHYGFEFPHDYPLTNMTNFENNIG… |
| A0A812YQN3 | 451-658 | None |
| A0A813BUR6 | 130-367 | None |
| A0A7S4RPA0 | 478-750 | None |
| A0A7S4SI08 | 326-547 | None |
| A0A7S4SI55 | 337-554 | None |
| A0A5M8P8J6 | 22-219 | None |
| A0A1F7BUR8 | 17-170 | None |
| A0A2N9CM31 | 93-312 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.