DPCstruct | MC22994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.13 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0HMK1 | 24-182 | NVYYILDNRNKPFKVVINGKTIKILKNLDKYLEYEKTPSLTFNANKIFIGYSPKTEMTLISDGYGPKYNGNSILLYIKDNEYVYIGH… |
| A0A6C0C6X1 | 124-306 | DKYKNCDLYKTLDNYSIGFIVLINRENNETHVYGITRDVLPDDYNGDEIVLFDRLIVKYKPSEIFVGKSIFNEMTDFSGGYGEVWDG… |
| A0A6C0I1U7 | 141-324 | None |
| A0A2J7ZLM5 | 76-217 | None |
| A0A6C0DGR0 | 2-181 | None |
| A0A7S1G6W5 | 23-223 | None |
| A0A812R240 | 78-246 | None |
| F0YE11 | 86-264 | None |
| A0A6C0CNB7 | 1-156 | None |
| A0A6C0KVT2 | 49-230 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.