DPCstruct | MC2299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 103 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 8.30 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.57 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.31 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00172 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y3MYT7 | 29-83 | NSNSNDNEIEKKESKRKKVSQACENCRKKRRKCSGDRPKCITCQQNNYICYYNPC |
| D8QGE1 | 2-62 | SQSANSSMSALNYDGPRVPRRTPMACEFCRRKLKCDGGRPSCANCEKKKFPCNYVPVYVPS |
| M2N156 | 64-129 | None |
| A0A1J8PM84 | 358-439 | None |
| A0A1B7Y7L7 | 1-58 | None |
| A0A1L9U837 | 1-69 | None |
| A0A127Z8T3 | 2-67 | None |
| A0A842Z0N5 | 1-66 | None |
| A0A438NFQ1 | 1-64 | None |
| A0A2V1D679 | 4-68 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.