DPCstruct | MC22989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 204 ± 17 aa |
| Standard deviation of domain lengths | 17.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0F8H1 | 5-208 | DVDLIQRVKVAGIFLLQVYKVTTGTMLSLFIPQACDNGQICSLKQNYENSDGYHQTVFYWNAFSMITFFTYYMVELAREEWAIKYLD… |
| A0A6C0C346 | 1-194 | MATFLVIFVPQKCDDEVCTISNNFLKRDSLYFAALVSNFITFTSVLYFYFVEIKRENWCIEYLDIDISKPNDYLDQEIESYPKYKKQ… |
| A0A6C0LTX6 | 100-294 | None |
| A0A7S0M3M2 | 40-272 | None |
| A0A2E1RK05 | 1-215 | None |
| A0A6C0I0J8 | 33-238 | None |
| A0A2E3WL86 | 7-177 | None |
| A0A6C0E998 | 1-230 | None |
| A0A6C0IQF3 | 28-224 | None |
| A0A6C0BUJ9 | 192-390 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.