DPCstruct | MC22984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 120 ± 13 aa |
| Standard deviation of domain lengths | 13.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 26.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A172XRJ3 | 1-114 | MCTPNTELQFCTCVEGDIYEVKDIYIWTLSMYIDSKKSMIRGKIMKSTEDFENGISAENIISKLNEENIFDFEYTPKERDTLHISFN… |
| A0A2T6C565 | 1-150 | MCEVSKTIKFCSCKDNLSEAHKHAKSMYYVWTLERVTGLSELAMDGLLMEEPTQLDELSAEKIVKELNSKNLFDFDYQPINDDTLEI… |
| A0A376GC90 | 17-127 | None |
| A0A1G7BDK7 | 1-120 | None |
| A0A2U0DMV7 | 1-107 | None |
| K2Q414 | 1-117 | None |
| A0A6S6TK49 | 17-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.