DPCstruct | MC22983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 98 ± 14 aa |
| Standard deviation of domain lengths | 13.55 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A808K1K1 | 14-119 | SLIASVAQKLSLFAQNAGMKLFAGKGKVEIQAHDDNIELTAQKSVKLISATQTIEGVAKQEILLTSGGAYIRLKDGNIEIHSPGAID… |
| A0A378PS21 | 7-83 | LMLMMPKIQIQAQSDDIEIIAEQVLKLISAKNNIEIVADKEIILTSNGSYIKIDKEGVEIGSPKKIKLHSSVEVLGG |
| A0A4Y9T1X6 | 1-104 | None |
| A0A2R2IXK1 | 1-70 | None |
| A0A7G2SFA8 | 340-443 | None |
| A0A0Q0EGI0 | 3-97 | None |
| A0A1E2V818 | 570-647 | None |
| A0A7C2DS43 | 136-222 | None |
| A0A1C0TYE6 | 106-211 | None |
| A0A3S0EGZ6 | 97-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.