DPCstruct | MC22980
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 145 ± 10 aa |
| Standard deviation of domain lengths | 10.03 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F3GU25 | 224-353 | GDLVTSLTDKVIVSASGTFNEANVTLNNVGCVEDTFTLTFTSATAFTCAGTYEGSIGSGTVGTTFAPTNPTVAAAFFSIPSSCWGGS… |
| A0A2Z4R538 | 1-135 | MWQDTRIGDEPLNRLNVKDYPIVLTDDGAIDEKWLIKFTSSSQFELYGQTLGFVLKTDTLQDLAPINPSTKKPYFTIPKQAFGADTP… |
| A0A1H0N1G9 | 310-460 | None |
| A0A2G6ZNS1 | 778-925 | None |
| A0A839HDT6 | 488-636 | None |
| A0A845TLM7 | 381-529 | None |
| A0A2G6PDU6 | 210-364 | None |
| A0A256WGB3 | 242-359 | None |
| A0A378TX08 | 471-620 | None |
| A0A1Y1J1F3 | 112-258 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.