DPCstruct | MC22975
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.13 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A485BSD3 | 1-71 | MELYLDTANVAEVERLARIYPLAGVTTNPSIIAAGKTPIWDVLPRLQKAIGPDGTLFAQTMSRDAESMVRK |
| A0A1C3TBA8 | 1-69 | MKFFIDTANLEDIKKAYKLGVLAGVTTNPSLVAKEGIKFEDRIAEICQAVPNVESVSAEVTQMLLQLKK |
| A0A7V1D6Q2 | 67-126 | None |
| A0A7Y8IXB7 | 1-64 | None |
| A0A537GBQ5 | 260-320 | None |
| A0A3M1CKL0 | 194-253 | None |
| A0A2V7FAL7 | 1-60 | None |
| A0A7R8WZK5 | 55-112 | None |
| A0A812L6G8 | 1-59 | None |
| A0A7R8W0L1 | 7-69 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.