DPCstruct | MC22973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 11.21 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 94.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 35.62 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0137- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2REB2 | 2-115 | GDRLDTDILGGNRAGFATAAVLTGVDTPESILAARSSERPGYLLADLTELYEPYPEIVEEDSTFRCGKATAEVQDGLITVSGSEKDL… |
| X8CVI8 | 2-126 | IGDRLDTDIEGANAAELPSLMVLTGVNSARDAVYAKPAQRPTYIGHDLRSLHADAERLAVGPQPGWRVDVADGAITVSGDGPDDGDG… |
| A0A838H7N1 | 151-270 | None |
| A0A0K2R0J3 | 23-152 | None |
| A0A3N4G725 | 519-662 | None |
| A0A849BTV7 | 233-367 | None |
| A0A6B2DU32 | 83-203 | None |
| A0A4D4M4H5 | 17-136 | None |
| A0A077LYX6 | 98-217 | None |
| A0A5S4ZLR0 | 17-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.