DPCstruct | MC22971
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 232 ± 25 aa |
| Standard deviation of domain lengths | 24.97 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13099 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2F463 | 3-247 | DIFSSLTLADYTFLVALIQSPFNLTDDRRLQALLATYEQEGTEEARAALNRQLERELRYLGSADVAYFIRYVAGRDPGAPFQEIVRD… |
| A0A553G5V7 | 272-475 | ILYHANKTEIDNLLKILDITSTSLIKEKLQSKSKNLLNSFDEYTYLDVVDKVMNHLSINDSHLTIAQKEQKIVEKSFQKALNKLTKE… |
| A0A7X0NKH6 | 11-251 | None |
| A0A7G9GZF0 | 8-249 | None |
| A0A1H6GLX4 | 1-225 | None |
| A0A4R6QFD7 | 106-308 | None |
| A0A0A8GQI9 | 8-248 | None |
| A0A6M8SXC4 | 8-261 | None |
| A0A5B7ZRC4 | 89-323 | None |
| A0A7V8VDX9 | 175-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.