DPCstruct | MC2297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 57 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H9TDV0 | 16-65 | KMRKCLYCKENISDESVIDFCERCGKGVWGEKMFNTILNKMESSRDKGDL |
| A0A7C4Y3U2 | 1-58 | MVKRCVYCKAELDEKSLIDVCKRCGIAVWGEKMFNAILKNMESAKDEGIYDQGSLSTK |
| A0A2D6NGX2 | 1-60 | None |
| A0A842NM25 | 1-60 | None |
| A0A1S6HEW9 | 27-86 | None |
| A0A842U4Y8 | 2-53 | None |
| A0A1J4ZFL1 | 1-58 | None |
| A0A1S6H8Q1 | 2-60 | None |
| A0A831K5M0 | 2-61 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.