DPCstruct | MC22967
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 90 ± 7 aa |
| Standard deviation of domain lengths | 7.44 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A379LSE5 | 3-103 | HFKLGYAGKHGVGGAAGVLPSPYTKAGRQMRDRLASLGVLRESTKQDHFRGCVVVPIIGWSGAASVGQRERVMQLYGRRSVEDAKVN… |
| A0A5C5W9M1 | 48-132 | LDQFRIGYANRTLGLKLPGKHLKSGKQIRGRLEALNIFRPKSGHEQFNGCVVFPIQSPDGTGRIVDIYGRKTGSHLRKGTPLDMF |
| A0A7I8BJ85 | 1-92 | None |
| A0A5C5ZIM3 | 42-123 | None |
| A0A516HCR8 | 71-153 | None |
| B9NWZ6 | 24-114 | None |
| Q84BA2 | 161-263 | None |
| A0A848A0X0 | 157-240 | None |
| A0A3A3FF67 | 158-245 | None |
| A0A0Q0CVF9 | 47-130 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.