DPCstruct | MC22966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Standard deviation of domain lengths | 22.97 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 39.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13265 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K7S7R7 | 6-155 | IPGIKLTETTSLDKIGPHHYLGDASEENGIIYSRRGGFIDMAHLRDQSDWTAYLYTQILEHKKKGSLSIILGREGGEKTLNVSIPTN… |
| A0A379FLK4 | 7-182 | AMGIALLLAACQSHDKLELPAIEPVITPYTFEAASQAWPVVASLAPPQGLRACCAFGYNLQAELWGLPVPFYTIDNIVEADSLGEHH… |
| A0A812GS41 | 7-184 | None |
| A0A6N1YE18 | 50-220 | None |
| A0A1V8M8P8 | 40-261 | None |
| A0A1Y5FGD0 | 1-168 | None |
| A0A2S3QU77 | 8-223 | None |
| R4Y8V7 | 2-205 | None |
| A0A826KCZ7 | 11-216 | None |
| A0A6M1CLC5 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.