DPCstruct | MC22964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 191 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 15.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 86.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 16.46 |
| Pfam Score | 10.71 |
| Assigned Pfam label(s) | CL0301- PF18906- PF02924- CL0373- PF07195 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C2CG97 | 100-222 | IEPDTVKATGTLTLAVQPTVGDTLTIGANTYTFVAAGTAGAVGEVSVGDDLAGAKLALVGVINGTDGLNTSHPLVSASAFVGDVCTL… |
| A0A2X2FEE6 | 6-122 | IEDAAAGKKASATLTITAPATRGGTLSLFVCGERLDIPVETADTVSVLNQAVVDIVNANTHLPLVAALTGEANGTVTLTARQSGDWG… |
| A0A7D5S0L9 | 91-215 | None |
| A0A1G3M002 | 80-197 | None |
| A0A1F5QSV0 | 71-180 | None |
| A0A1F5QTK7 | 13-127 | None |
| A0A848L7M4 | 587-709 | None |
| A0A2D7XB49 | 144-270 | None |
| A0A0F9GTE6 | 5-136 | None |
| A0A0F9MXZ0 | 77-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.