DPCstruct | MC22963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 153 ± 30 aa |
| Standard deviation of domain lengths | 29.81 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 87.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4N041 | 10-173 | GGSWQKSQFRLKFIARTLISPKLTFNLLGVLVKQPFLNSMLRAQPDLPCKLHRPYLANTLNNRQKLEVLQAHFQLVNQCIPELLRRN… |
| A0A379B9R5 | 4-160 | DFIINNVGSLISFLNQHSLWIPLFQQHPYRVNGLLSTYCNRRWGGSQRLQAITTNLMVATAKFGVERCQHLLAKGTLTLATLTDSLS… |
| A0A133LLG1 | 2-104 | None |
| Q7VM16 | 11-190 | None |
| A0A254TFX1 | 163-328 | None |
| A0A370X4S0 | 67-248 | None |
| A0A6G3I4N0 | 18-185 | None |
| A0A2X2T2R9 | 27-196 | None |
| A0A643F7X1 | 27-221 | None |
| F5NVP0 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.