DPCstruct | MC22962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07356 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7EB15 | 69-206 | EVNVYSQPPEHIRVRFDDRGELSFMQREVNGQKQQLSSDQIALYRYRAEQIRQTSDALRQGRVELHQGSWHKDGTVTTCEGQTVKTG… |
| A0A2X2DK57 | 1-142 | MANSQPNLESKNGDITEQLRFDKNNEVIFMQRTQDGYKTPLSTDEITRWRFEAERILETNTALIVGGVKLYQGRWHQGKVTTCEGDV… |
| D4BL24 | 1-127 | None |
| A0A2N5DTX9 | 92-231 | None |
| A0A655RUS1 | 26-157 | None |
| A0A2X2T757 | 52-180 | None |
| A0A090RF67 | 87-217 | None |
| A0A655ZM51 | 1-107 | None |
| A0A6G0W136 | 307-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.