DPCstruct | MC22961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 146 ± 16 aa |
| Standard deviation of domain lengths | 15.57 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8FS63 | 2-134 | KAIWISVLDNPHPLKFIDPTNEQQCAWAWEYLQKHGVSMSIFHPTNNREEYLSAVASIDLNPSHRDTKKIFLMSMKKAYDQKKYREK… |
| A0A2K8JZW8 | 257-399 | RVVFIETRTHPKDLEWIDKSNHSQLIWAIDYLKKNNFLISPLNFYPNDAKQMFAQICASIDLIAIREKIASGNLAYSPIQELFLQKM… |
| A0A827TXK0 | 18-191 | None |
| A0A3D8GXR9 | 46-182 | None |
| A0A3A6RSW4 | 5-148 | None |
| A0A7D6WLT6 | 112-288 | None |
| A0A1X0VWR8 | 197-336 | None |
| A0A6D0R4E0 | 2-119 | None |
| A0A483NEM3 | 148-309 | None |
| A0A6H1Y5N2 | 162-296 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.