DPCstruct | MC22960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 162 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8FIM7 | 11-191 | DRRFLSEQRQSVRVSMASLFDEMFGKNTRLTAGARIVIHGKNYMDMYDHAAGFAFFTQDSDRTVEAMPYTTLSAIRVQAEGVFQSLS… |
| A0A2A2DNR1 | 29-186 | FVRQFQVRLFSQTEYVDDDPLEGTYWMNEASLVGQCGLLDDATTLAEAAVRHMLNRSVPFHQDPGRPLRFAPRRIVINDRFGNQVLY… |
| A0A7Y7VQC8 | 136-306 | None |
| A0A7L5RPZ6 | 12-180 | None |
| A0A1S7PI29 | 1-143 | None |
| A0A837Z295 | 107-285 | None |
| A0A7X3HRP4 | 2-155 | None |
| A0A316JN57 | 25-178 | None |
| A0A761LXL7 | 116-272 | None |
| A0A2V3PWP3 | 138-295 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.